PDB entry 1wi2

View 1wi2 on RCSB PDB site
Description: Solution structure of the PDZ domain from RIKEN cDNA 2700099C19
Class: structural genomics, unknown function
Keywords: structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2004-05-28, released 2004-11-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: RIKEN cDNA 2700099C19
  Species: Mus musculus [TaxId:10090]
  Gene: RIKEN cDNA 2700099C19
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9CZG9 (7-97)
    • cloning artifact (0-6)
    • cloning artifact (98-103)
  Domains in SCOPe 2.08: d1wi2a1, d1wi2a2, d1wi2a3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wi2A (A:)
  gssgssgnneltqflprivtlkkppgaqlgfnirggkasqlgifiskvipdsdahraglq
  egdqvlavndvdfqdiehskaveilktareismrvrffsgpssg