PDB entry 1wi1

View 1wi1 on RCSB PDB site
Description: Solution structure of the PH domain of human calcium-dependent activator protein for secretion (CAPS)
Class: endocytosis/exocytosis
Keywords: PH domain, Calcium-dependent activator protein for secretion (CAPS), PIP2 binding site, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, ENDOCYTOSIS/EXOCYTOSIS COMPLEX
Deposited on 2004-05-28, released 2004-11-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: calcium-dependent activator protein for secretion, CAPS
  Species: Homo sapiens [TaxId:9606]
  Gene: KAZUSA cDNA hh10147
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8NFR0 (7-119)
    • cloning artifact (0-6)
    • cloning artifact (120-125)
  Domains in SCOPe 2.06: d1wi1a1, d1wi1a2, d1wi1a3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wi1A (A:)
  gssgssgmkhsgylwaigknvwkrwkkrffvlvqvsqytfamcsyrekkaepqellqldg
  ytvdytdpqpgleggraffnavkegdtvifasddeqdrilwvqamyratgqshkpvpptq
  sgpssg