PDB entry 1why

View 1why on RCSB PDB site
Description: Solution structure of the RNA recognition motif from hypothetical RNA binding protein BC052180
Class: RNA binding protein
Keywords: RNA recognition motif, RRM, RNA binding domain, RBD, RNP, STRUCTURAL GENOMICS, RIKEN Structural Genomics/Proteomics Initiative, RSGI, RNA BINDING PROTEIN
Deposited on 2004-05-28, released 2004-11-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein RIKEN cDNA 1810017N16
    Species: Mus musculus [TaxId:10090]
    Gene: RIKEN CDNA 1810017N16
    Database cross-references and differences (RAF-indexed):
    • GB NP_780611 (7-90)
      • cloning artifact (0-6)
      • cloning artifact (91-96)
    Domains in SCOPe 2.07: d1whya1, d1whya2, d1whya3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1whyA (A:)
    gssgssgkigygkanpttrlwvgglgpntslaalarefdrfgsirtidhvkgdsfayiqy
    esldaaqaacakmrgfplggpdrrlrvdfaksgpssg