PDB entry 1whv

View 1whv on RCSB PDB site
Description: Solution structure of the RNA binding domain from hypothetical protein BAB23382
Class: hydrolase
Keywords: RNA recognition motif, RRM, RNA binding domain, RBD, RNP, poly(A)-specific ribonuclease, PARN, STRUCTURAL GENOMICS, RIKEN Structural Genomics/Proteomics Initiative, RSGI, HYDROLASE
Deposited on 2004-05-28, released 2004-11-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Poly(A)-specific Ribonuclease
  Species: Mus musculus [TaxId:10090]
  Gene: RIKEN cDNA 1200003I18
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8VDG3 (7-93)
    • cloning artifact (0-6)
    • cloning artifact (94-99)
  Domains in SCOPe 2.07: d1whva1, d1whva2, d1whva3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1whvA (A:)
  gssgssggpdlqpkrdhvlhvtfpkewktsdlyqlfsafgniqiswiddtsafvslsqpe
  qvqiavntskyaesyriqtyaeyvgkkqkgkqvksgpssg