PDB entry 1whu

View 1whu on RCSB PDB site
Description: Solution structure of the alpha-helical domain from mouse hypothetical PNPase
Class: transferase
Keywords: Polynucleotide phosphorylase, PNPase, alpha-helical domain, 3'-5' RNA exonuclease, STRUCTURAL GENOMICS, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSFERASE
Deposited on 2004-05-28, released 2004-11-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: polynucleotide phosphorylase; 3'-5' RNA exonuclease
    Species: Mus musculus [TaxId:10090]
    Gene: RIKEN CDNA 1200003F12
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8K1R3 (7-97)
      • cloning artifact (0-6)
      • cloning artifact (98-103)
    Domains in SCOPe 2.07: d1whua1, d1whua2, d1whua3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1whuA (A:)
    gssgssgpqkiftpsaeivkytkiiameklyavftdyehdkvsrdeavnkirldteehlk
    ekfpevdqfeiiesfnivakevfrsiilneykrcdgrdsgpssg