PDB entry 1wht

View 1wht on RCSB PDB site
Description: structure of the complex of l-benzylsuccinate with wheat serine carboxypeptidase II at 2.0 angstroms resolution
Class: serine carboxypeptidase
Keywords: serine carboxypeptidase
Deposited on 1994-03-07, released 1994-06-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serine carboxypeptidase II
    Species: Triticum aestivum [TaxId:4565]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wht.1
  • Chain 'B':
    Compound: serine carboxypeptidase II
    Species: Triticum aestivum [TaxId:4565]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wht.1
  • Heterogens: NAG, FUC, NDG, BZS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1whtA (A:)
    ghaadriarlpgqpavdfdmysgyitvdegagrslfyllqeapedaqpaplvlwlnggpg
    cssvaygaseelgafrvkprgaglvlneyrwnkvanvlfldspagvgfsytntssdiyts
    gdnrtahdsyaflakwferfphykyrdfyiagesyaghyvpelsqlvhrsknpvinlkgf
    mvgngliddyhdyvgtfefwwnhgivsddtyrrlkeaclhdsfihpspacdaatdvatae
    qgnidmyslytpvcni
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1whtB (B:)
    sydpcterystayynrrdvqmalhanvtgamnytwatcsdtinthwhdaprsmlpiyrel
    iaaglriwvfsgdtdavvpltatrysigalglptttswypwyddqevggwsqvykgltlv
    svrgaghevplhrprqalvlfqyflqgkpmpgq