PDB entry 1whq

View 1whq on RCSB PDB site
Description: Solution structure of the N-terminal dsRBD from hypothetical protein BAB28848
Class: RNA binding protein
Keywords: double-stranded RNA binding domain, dsRBD, DSRM, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics
Deposited on 2004-05-28, released 2004-11-28
The last revision prior to the SCOP 1.73 freeze date was dated 2004-11-28, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA helicase A
    Species: MUS MUSCULUS
    Gene: RIKEN cDNA 2810480H04
    Database cross-references and differences (RAF-indexed):
    • Uniprot O70133 (7-92)
      • cloning artifact (0-6)
      • cloning artifact (93-98)
    Domains in SCOP 1.73: d1whqa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1whqA (A:)
    gssgssgiknflyawcgkrkmtpayeiravgnknrqkfmcevrvegfnyagmgnstnkkd
    aqsnaardfvnylvrinevkseevpavgivpppsgpssg