PDB entry 1whq

View 1whq on RCSB PDB site
Description: Solution structure of the N-terminal dsRBD from hypothetical protein BAB28848
Class: RNA binding protein
Keywords: double-stranded RNA binding domain, dsRBD, DSRM, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, RNA BINDING PROTEIN
Deposited on 2004-05-28, released 2004-11-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA helicase A
    Species: Mus musculus [TaxId:10090]
    Gene: RIKEN cDNA 2810480H04
    Database cross-references and differences (RAF-indexed):
    • Uniprot O70133 (7-92)
      • cloning artifact (0-6)
      • cloning artifact (93-98)
    Domains in SCOPe 2.08: d1whqa1, d1whqa2, d1whqa3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1whqA (A:)
gssgssgiknflyawcgkrkmtpayeiravgnknrqkfmcevrvegfnyagmgnstnkkd
aqsnaardfvnylvrinevkseevpavgivpppsgpssg