PDB entry 1whp

View 1whp on RCSB PDB site
Description: allergen phl p 2
Class: allergen
Keywords: timothy grass pollen allergen, allergen
Deposited on 1997-04-04, released 1997-07-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.192
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: allergen phl p 2
    Species: Phleum pratense [TaxId:15957]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1whpa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1whpA (A:)
    vpkvtftvekgsnekhlavlvkyegdtmaevelrehgsdewvamtkgeggvwtfdseepl
    qgpfnfrfltekgmknvfddvvpekytigatyapee
    

    Sequence, based on observed residues (ATOM records): (download)
    >1whpA (A:)
    vpkvtftvekgsnekhlavlvkyegdtmaevelrehgsdewvamtkgeggvwtfdseepl
    qgpfnfrfltekgmknvfddvvpekytigatyap