PDB entry 1whn

View 1whn on RCSB PDB site
Description: Solution structure of the dsRBD from hypothetical protein BAB26260
Class: RNA binding protein
Keywords: double-stranded RNA binding domain, dsRBD, DSRM, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, RNA BINDING PROTEIN
Deposited on 2004-05-28, released 2004-11-28
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hypothetical protein RIKEN cDNA 2310016K04
  Species: Mus musculus [TaxId:10090]
  Gene: RIKEN cDNA 2310016K04
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9D7B1 (7-121)
    • cloning artifact (0-6)
    • cloning artifact (122-127)
  Domains in SCOPe 2.05: d1whna_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1whnA (A:)
  gssgssgsgiikmairfdrrayppqitpkmcllewcrreklpqpvyetvqrtidrmfcsv
  vtvaeqkyqstlwdkskklaeqtaaivclrsqglpegrlgeespslnkrkreapdqdpgg
  prsgpssg