PDB entry 1whm

View 1whm on RCSB PDB site
Description: Solution structure of the 2nd CAP-Gly domain in human cylindromatosis tumor suppressor CYLD
Class: antitumor protein
Keywords: Tumor suppressor, deubiquitinating enzyme, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, ANTITUMOR PROTEIN
Deposited on 2004-05-28, released 2004-11-28
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cylindromatosis tumor suppressor CYLD
    Species: Homo sapiens [TaxId:9606]
    Gene: Kazusa cDNA fh04363
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NQC7 (7-85)
      • cloning artifact (0-6)
      • cloning artifact (86-91)
    Domains in SCOPe 2.05: d1whma_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1whmA (A:)
    gssgssgppleinsrvslkvgetiesgtvifcdvlpgkeslgyfvgvdmdnpignwdgrf
    dgvqlcsfacvestillhindiipessgpssg