PDB entry 1whk

View 1whk on RCSB PDB site
Description: Solution structure of the 3rd CAP-Gly domain in mouse 1700024K14Rik hypothetical protein
Class: structural genomics, unknown function
Keywords: structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2004-05-28, released 2004-11-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RIKEN cDNA 1700024K14
    Species: Mus musculus [TaxId:10090]
    Gene: RIKEN cDNA 5830409B12
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8CI96 (7-84)
      • cloning artifact (0-6)
      • cloning artifact (85-90)
    Domains in SCOPe 2.07: d1whka1, d1whka2, d1whka3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1whkA (A:)
    gssgssgegtvklhegsqvlltssnematvryvgptdfasgiwlglelrsakgkndgavg
    dkryftckpnygvlvrpsrvtyrgisgpssg