PDB entry 1whj

View 1whj on RCSB PDB site
Description: Solution structure of the 1st CAP-Gly domain in mouse 1700024K14Rik hypothetical protein
Class: structural genomics, unknown function
Keywords: structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2004-05-28, released 2004-11-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: RIKEN cDNA 1700024K14
  Species: Mus musculus [TaxId:10090]
  Gene: RIKEN cDNA 5830409B12
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8CI96 (7-95)
    • cloning artifact (0-6)
    • cloning artifact (96-101)
  Domains in SCOPe 2.07: d1whja1, d1whja2, d1whja3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1whjA (A:)
  gssgssglpnsdhttsramltslglklgdrvviagqkvgtlrfcgttefasgqwagield
  epegknngsvgrvqyfkcapkygifaplskisklkdsgpssg