PDB entry 1whi

View 1whi on RCSB PDB site
Description: ribosomal protein l14
Deposited on 1996-01-10, released 1996-08-17
The last revision prior to the SCOP 1.61 freeze date was dated 1996-08-17, with a file datestamp of 1996-09-19.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.189
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.61: d1whi__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1whi_ (-)
    miqqesrlkvadnsgarevlvikvlggsgrryanigdvvvatvkdatpggvvkkgqvvka
    vvvrtkrgvrrpdgsyirfdenacviirddksprgtrifgpvarelrdkdfmkiislape
    vi