PDB entry 1whh

View 1whh on RCSB PDB site
Description: Solution structure of the 2nd CAP-Gly domain in mouse CLIP170-related 59kDa protein CLIPR-59
Class: structural protein
Keywords: microtubule binding, trans-Golgi Network, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, STRUCTURAL PROTEIN
Deposited on 2004-05-28, released 2004-11-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: clipr-59
    Species: Mus musculus [TaxId:10090]
    Gene: RIKEN cDNA 1500005P14
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9DB67 (7-95)
      • cloning artifact (0-6)
      • cloning artifact (96-101)
    Domains in SCOPe 2.07: d1whha1, d1whha2, d1whha3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1whhA (A:)
    gssgssgkspsspslgslqqregakaevgdqvlvagqkqgivrfygktdfapgywygiel
    dqptgkhdgsvfgvryftcaprhgvfapasriqrigsgpssg