PDB entry 1whg

View 1whg on RCSB PDB site
Description: Solution structure of the CAP-Gly domain in mouse tubulin specific chaperone B
Class: chaperone
Keywords: microtubule binding, cytoskeleton associated protein, CKAPI, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, CHAPERONE
Deposited on 2004-05-28, released 2004-11-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tubulin specific chaperone B
    Species: Mus musculus [TaxId:10090]
    Gene: RIKEN cDNA 2410007D12
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9D1E6 (7-106)
      • cloning artifact (0-6)
      • cloning artifact (107-112)
    Domains in SCOPe 2.07: d1whga1, d1whga2, d1whga3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1whgA (A:)
    gssgssgneelraqqeaeaaqrlseekaqasaisvgsrcevrapdhslrrgtvmyvgltd
    fkpgywvgvrydeplgkndgsvngkryfecqakygafvkpsavtvgdsgpssg