PDB entry 1whd

View 1whd on RCSB PDB site
Description: Solution structure of the PDZ domain of RGS3
Class: signaling protein
Keywords: Regulator of G-protein signaling, PDZ domain, Structural Genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN
Deposited on 2004-05-28, released 2004-11-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Regulator of G-protein signaling 3
  Species: Mus musculus [TaxId:10090]
  Gene: RIKEN cDNA 4930506N09
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9DC04 (7-93)
    • cloning artifact (0-6)
    • cloning artifact (94-99)
  Domains in SCOPe 2.06: d1whda1, d1whda2, d1whda3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1whdA (A:)
  gssgssgegdpengeklqitirrgkdgfgfticcdspvrvqavdsggpaeraglqqldtv
  lqlnerpvehwkcvelaheirscpseiillvwrvsgpssg