PDB entry 1whc

View 1whc on RCSB PDB site
Description: solution structure of rsgi ruh-027, a uba domain from mouse cdna
Deposited on 2004-05-28, released 2004-11-28
The last revision prior to the SCOP 1.71 freeze date was dated 2004-11-28, with a file datestamp of 2004-11-28.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1whca_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1whcA (A:)
    gssgssgaeltalesliemgfprgraekalaltgnqgieaamdwlmeheddpdvdeplsg
    pssg