PDB entry 1whb

View 1whb on RCSB PDB site
Description: Solution structure of the Rhodanese-like domain in human ubiquitin specific protease 8 (UBP8)
Class: hydrolase
Keywords: deubiqutinating enzyme, ubpy, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, hydrolase
Deposited on 2004-05-28, released 2004-11-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: kiaa0055
  Species: Homo sapiens [TaxId:9606]
  Gene: Kazusa cDNA ha01049
  Database cross-references and differences (RAF-indexed):
  • Uniprot P40818 (7-150)
    • cloning artifact (0-6)
    • cloning artifact (151-156)
  Domains in SCOPe 2.06: d1whba1, d1whba2, d1whba3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1whbA (A:)
  gssgssgkcetkekgaitakelytmmtdknisliimdarrmqdyqdscilhslsvpeeai
  spgvtaswieahlpddskdtwkkrgnveyvvlldwfssakdlqigttlrslkdalfkwes
  ktvlrneplvleggyenwllcypqyttnakvsgpssg