PDB entry 1wha

View 1wha on RCSB PDB site
Description: Solution structure of the second PDZ domain of human scribble (KIAA0147 protein).
Class: signaling protein
Keywords: PDZ DOMAIN, Cellular signaling, Structural Genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN
Deposited on 2004-05-28, released 2004-11-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: KIAA0147 protein
  Species: Homo sapiens [TaxId:9606]
  Gene: Kazusa cDNA ha01022s1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q14160 (7-98)
    • cloning artifact (0-6)
    • cloning artifact (99-104)
  Domains in SCOPe 2.07: d1whaa1, d1whaa2, d1whaa3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1whaA (A:)
  gssgssgrhvaclarserglgfsiaggkgstpyragdagifvsriaeggaahragtlqvg
  drvlsingvdvtearhdhavslltaasptialllereagsgpssg