PDB entry 1wh9

View 1wh9 on RCSB PDB site
Description: Solution structure of the KH domain of human ribosomal protein S3
Class: ribosome
Keywords: KH domain, Structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, RIBOSOME
Deposited on 2004-05-28, released 2004-11-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: 40S ribosomal protein S3
  Species: Homo sapiens [TaxId:9606]
  Gene: IMS cDNA adKA01519
  Database cross-references and differences (RAF-indexed):
  • Uniprot P23396 (7-85)
    • cloning artifact (0-6)
    • cloning artifact (86-91)
  Domains in SCOPe 2.06: d1wh9a1, d1wh9a2, d1wh9a3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wh9A (A:)
  gssgssgfkaelnefltrelaedgysgvevrvtptrteiiilatrtqnvlgekgrrirel
  tavvqkrfgfpegsvelyaekvatrgsgpssg