PDB entry 1wh9

View 1wh9 on RCSB PDB site
Description: Solution structure of the KH domain of human ribosomal protein S3
Class: ribosome
Keywords: KH domain, Structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, RIBOSOME
Deposited on 2004-05-28, released 2004-11-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 40S ribosomal protein S3
    Species: Homo sapiens [TaxId:9606]
    Gene: IMS cDNA adKA01519
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23396 (7-85)
      • cloning artifact (0-6)
      • cloning artifact (86-91)
    Domains in SCOPe 2.07: d1wh9a1, d1wh9a2, d1wh9a3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wh9A (A:)
    gssgssgfkaelnefltrelaedgysgvevrvtptrteiiilatrtqnvlgekgrrirel
    tavvqkrfgfpegsvelyaekvatrgsgpssg