PDB entry 1wh8

View 1wh8 on RCSB PDB site
Description: Solution structure of the third CUT domain of human Homeobox protein Cux-2
Class: transcription
Keywords: CUT domain, Structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSCRIPTION
Deposited on 2004-05-28, released 2004-11-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Homeobox protein Cux-2
    Species: Homo sapiens [TaxId:9606]
    Gene: KAZUSA cDNA hg03205
    Database cross-references and differences (RAF-indexed):
    • Uniprot O14529 (7-104)
      • cloning artifact (0-6)
      • cloning artifact (105-110)
    Domains in SCOPe 2.08: d1wh8a1, d1wh8a2, d1wh8a3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wh8A (A:)
    gssgssgysgsqapggiqeivamspeldtysitkrvkevltdnnlgqrlfgesilgltqg
    svsdllsrpkpwhklslkgrepfvrmqlwlndphnveklrdmkklsgpssg