PDB entry 1wh7

View 1wh7 on RCSB PDB site
Description: Solution structure of homeobox domain of Arabidopsis thaliana hypothetical protein F22K18.140
Class: DNA binding protein
Keywords: homeobox domain, ZF-HD homeobox family protein, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, DNA BINDING PROTEIN
Deposited on 2004-05-28, released 2004-11-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ZF-HD homeobox family protein
  Species: Arabidopsis thaliana [TaxId:3702]
  Gene: RIKEN cDNA RAFL09-85-E18
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9SB61 (7-73)
    • cloning artifact (0-6)
    • cloning artifact (74-79)
  Domains in SCOPe 2.08: d1wh7a1, d1wh7a2, d1wh7a3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wh7A (A:)
  gssgssgsnpsssggttkrfrtkftaeqkekmlafaerlgwriqkhddvaveqfcaetgv
  rrqvlkiwmhnnknsgpssg