PDB entry 1wh6

View 1wh6 on RCSB PDB site
Description: Solution structure of the second CUT domain of human Homeobox protein Cux-2
Class: transcription
Keywords: CUT domain, Structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSCRIPTION
Deposited on 2004-05-28, released 2004-11-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Homeobox protein Cux-2
    Species: Homo sapiens [TaxId:9606]
    Gene: KAZUSA cDNA hg03205
    Database cross-references and differences (RAF-indexed):
    • Uniprot O14529 (7-94)
      • cloning artifact (0-6)
      • cloning artifact (95-100)
    Domains in SCOPe 2.06: d1wh6a1, d1wh6a2, d1wh6a3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wh6A (A:)
    gssgssgqyelymyrevdtleltrqvkeklakngicqrifgekvlglsqgsvsdmlsrpk
    pwskltqkgrepfirmqlwlsdqlgqavgqqpgassgpssg