PDB entry 1wh6

View 1wh6 on RCSB PDB site
Description: Solution structure of the second CUT domain of human Homeobox protein Cux-2
Class: transcription
Keywords: CUT domain, Structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSCRIPTION
Deposited on 2004-05-28, released 2004-11-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Homeobox protein Cux-2
  Species: Homo sapiens [TaxId:9606]
  Gene: KAZUSA cDNA hg03205
  Database cross-references and differences (RAF-indexed):
  • Uniprot O14529 (7-94)
    • cloning artifact (0-6)
    • cloning artifact (95-100)
  Domains in SCOPe 2.08: d1wh6a1, d1wh6a2, d1wh6a3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wh6A (A:)
  gssgssgqyelymyrevdtleltrqvkeklakngicqrifgekvlglsqgsvsdmlsrpk
  pwskltqkgrepfirmqlwlsdqlgqavgqqpgassgpssg