PDB entry 1wh4

View 1wh4 on RCSB PDB site
Description: Solution structure of the DEATH domain of Interleukin-1 receptor-associated kinase4 (IRAK4) from Mus musculus
Class: transferase
Keywords: DEATH domain, Structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, transferase
Deposited on 2004-05-28, released 2004-11-28
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: interleukin-1 receptor-associated kinase 4
  Species: Mus musculus [TaxId:10090]
  Gene: RIKEN cDNA 9330209D03
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8R4K2 (7-120)
    • cloning artifact (0-6)
    • cloning artifact (121-126)
  Domains in SCOPe 2.05: d1wh4a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wh4A (A:)
  gssgssgmnkpltpstyirnlnvgilrklsdfidpqegwkklavaikkpsgddrynqfhi
  rrfeallqtgksptcellfdwgttnctvgdlvdllvqielfapatlllpdavpqtvkslp
  psgpssg