PDB entry 1wh4

View 1wh4 on RCSB PDB site
Description: solution structure of the death domain of interleukin-1 receptor- associated kinase4 (irak4) from mus musculus
Deposited on 2004-05-28, released 2004-11-28
The last revision prior to the SCOP 1.71 freeze date was dated 2004-11-28, with a file datestamp of 2004-11-28.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.71: d1wh4a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wh4A (A:)
  gssgssgmnkpltpstyirnlnvgilrklsdfidpqegwkklavaikkpsgddrynqfhi
  rrfeallqtgksptcellfdwgttnctvgdlvdllvqielfapatlllpdavpqtvkslp
  psgpssg