PDB entry 1wh4

View 1wh4 on RCSB PDB site
Description: Solution structure of the DEATH domain of Interleukin-1 receptor-associated kinase4 (IRAK4) from Mus musculus
Class: transferase
Keywords: DEATH domain, Structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, transferase
Deposited on 2004-05-28, released 2004-11-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: interleukin-1 receptor-associated kinase 4
    Species: Mus musculus [TaxId:10090]
    Gene: RIKEN cDNA 9330209D03
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8R4K2 (7-120)
      • cloning artifact (0-6)
      • cloning artifact (121-126)
    Domains in SCOPe 2.08: d1wh4a1, d1wh4a2, d1wh4a3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wh4A (A:)
    gssgssgmnkpltpstyirnlnvgilrklsdfidpqegwkklavaikkpsgddrynqfhi
    rrfeallqtgksptcellfdwgttnctvgdlvdllvqielfapatlllpdavpqtvkslp
    psgpssg