PDB entry 1wh3

View 1wh3 on RCSB PDB site
Description: Solution structure of C-terminal ubiquitin like domain of human 2'-5'-oligoadenylate synthetase-like protain (p59 OASL)
Class: protein binding
Keywords: p59 OASL, ubiquitin family, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, PROTEIN BINDING
Deposited on 2004-05-28, released 2004-11-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 59 kDa 2'-5'-oligoadenylate synthetase like protein
    Species: Homo sapiens [TaxId:9606]
    Gene: IMS cDNA adSE00628
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15646 (7-80)
      • cloning artifact (0-6)
      • cloning artifact (81-86)
    Domains in SCOPe 2.08: d1wh3a1, d1wh3a2, d1wh3a3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wh3A (A:)
    gssgssgiqvfvknpdggsyayainpnsfilglkqqiedqqglpkkqqqlefqgqvlqdw
    lglgiygiqdsdtlilskkkgsgpssg