PDB entry 1wh1

View 1wh1 on RCSB PDB site
Description: Solution structure of the fourth PDZ domain of KIAA1095 protein
Class: Structural genomics, unknown function
Keywords: PDZ domain, KIAA1095, Structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, unknown function
Deposited on 2004-05-28, released 2004-11-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: KIAA1095 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: Kazusa hk06736
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UPQ7 (7-117)
      • cloning artifact (0-6)
      • cloning artifact (118-123)
    Domains in SCOPe 2.08: d1wh1a1, d1wh1a2, d1wh1a3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wh1A (A:)
    gssgssgdihqemdreeleleevdlyrmnsqdklgltvcyrtddeddigiyiseidpnsi
    aakdgriregdriiqingievqnreeavalltseenknfslliarpelqldegwmdddsg
    pssg