PDB entry 1wgz

View 1wgz on RCSB PDB site
Description: crystal structure of carboxypeptidase 1 from thermus thermophilus
Deposited on 2004-05-28, released 2005-05-28
Made obsolete by 5wvu on 2017-02-22

The last revision was dated 2017-02-22, with a file datestamp of 2017-02-17.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: carboxypeptidase 1
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: carboxypeptidase 1
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: carboxypeptidase 1
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1wgzA (A:)
    mtpeaayqnllefqretaylaslgalaawdqrtmipkkghehrarqmaalarllhqrmtd
    prigewlekvegsplvqdplsdaavnvrewrqayeraraiperlavelaqaeseaesfwe
    earprddwrgflpylkrvyaltkekaevlfalppapgdppygelydalldgyepgmrare
    llplfaelkeglkglldrilgsgkrpdtsilhrpypveaqrrfalellsacgydleagrl
    dptahpfeiaigpgdvrittryyedffnagifgtlhemghalyeqglpkehwgtprgdav
    slgvhesqsrtwenlvgrslgfwerffprarevfaslgdvsledfhfavnavepslirve
    adevtynlhilvrlelelalfrgelspedlpeawaekyrdhlgvapkdykdgvmqdvhwa
    gglfgyfptytlgnlyaaqffqkaeaelgpleprfargefqpfldwtrarihaegsrfrp
    rvlvervtgeapsarpflaylekkyaalyg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >1wgzB (B:)
    mtpeaayqnllefqretaylaslgalaawdqrtmipkkghehrarqmaalarllhqrmtd
    prigewlekvegsplvqdplsdaavnvrewrqayeraraiperlavelaqaeseaesfwe
    earprddwrgflpylkrvyaltkekaevlfalppapgdppygelydalldgyepgmrare
    llplfaelkeglkglldrilgsgkrpdtsilhrpypveaqrrfalellsacgydleagrl
    dptahpfeiaigpgdvrittryyedffnagifgtlhemghalyeqglpkehwgtprgdav
    slgvhesqsrtwenlvgrslgfwerffprarevfaslgdvsledfhfavnavepslirve
    adevtynlhilvrlelelalfrgelspedlpeawaekyrdhlgvapkdykdgvmqdvhwa
    gglfgyfptytlgnlyaaqffqkaeaelgpleprfargefqpfldwtrarihaegsrfrp
    rvlvervtgeapsarpflaylekkyaalyg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >1wgzC (C:)
    mtpeaayqnllefqretaylaslgalaawdqrtmipkkghehrarqmaalarllhqrmtd
    prigewlekvegsplvqdplsdaavnvrewrqayeraraiperlavelaqaeseaesfwe
    earprddwrgflpylkrvyaltkekaevlfalppapgdppygelydalldgyepgmrare
    llplfaelkeglkglldrilgsgkrpdtsilhrpypveaqrrfalellsacgydleagrl
    dptahpfeiaigpgdvrittryyedffnagifgtlhemghalyeqglpkehwgtprgdav
    slgvhesqsrtwenlvgrslgfwerffprarevfaslgdvsledfhfavnavepslirve
    adevtynlhilvrlelelalfrgelspedlpeawaekyrdhlgvapkdykdgvmqdvhwa
    gglfgyfptytlgnlyaaqffqkaeaelgpleprfargefqpfldwtrarihaegsrfrp
    rvlvervtgeapsarpflaylekkyaalyg