PDB entry 1wgy

View 1wgy on RCSB PDB site
Description: RA domain of guanine nucleotide exchange factor for Rap1
Class: Signaling Protein
Keywords: ubiquitin fold, RA, guanine nucleotide exchange, Rap1, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, Signaling Protein
Deposited on 2004-05-28, released 2004-11-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Rap guanine nucleotide exchange factor 5
    Species: Homo sapiens [TaxId:9606]
    Gene: Kazusa cDNA ha06833
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92565 (7-97)
      • cloning artifact (0-6)
      • cloning artifact (98-103)
    Domains in SCOPe 2.06: d1wgya1, d1wgya2, d1wgya3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wgyA (A:)
    gssgssgeeifchvyitehsyvsvkakvssiaqeilkvvaekiqyaeedlalvaitfsge
    khelqpndlvisksleasgriyvyrkdladtlnpfaensgpssg