PDB entry 1wgy

View 1wgy on RCSB PDB site
Description: RA domain of guanine nucleotide exchange factor for Rap1
Class: Signaling Protein
Keywords: ubiquitin fold, RA, guanine nucleotide exchange, Rap1, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics
Deposited on 2004-05-28, released 2004-11-28
The last revision prior to the SCOP 1.73 freeze date was dated 2004-11-28, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Rap guanine nucleotide exchange factor 5
    Species: HOMO SAPIENS
    Gene: Kazusa cDNA ha06833
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92565 (7-97)
      • cloning artifact (0-6)
      • cloning artifact (98-103)
    Domains in SCOP 1.73: d1wgya_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wgyA (A:)
    gssgssgeeifchvyitehsyvsvkakvssiaqeilkvvaekiqyaeedlalvaitfsge
    khelqpndlvisksleasgriyvyrkdladtlnpfaensgpssg