PDB entry 1wgv

View 1wgv on RCSB PDB site
Description: Solution Structure of the CS Domain of Human KIAA1068 Protein
Class: Structural genomics, unknown function
Keywords: CS domain, HSP20-like fold, KIAA1068 protein, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, unknown function
Deposited on 2004-05-28, released 2004-11-28
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: KIAA1068 protein
  Species: Homo sapiens [TaxId:9606]
  Gene: KAZUSA cDNA hj05437
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8IVD9 (7-117)
    • cloning artifact (0-6)
    • cloning artifact (118-123)
  Domains in SCOPe 2.05: d1wgva_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wgvA (A:)
  gssgssgqknpdsyngavrenytwsqdytdlevrvpvpkhvvkgkqvsvalssssirvam
  leengervlmegklthkintesslwslepgkcvlvnlskvgeywwnailegeepididsg
  pssg