PDB entry 1wgu

View 1wgu on RCSB PDB site
Description: Solution Structure of the C-terminal Phosphotyrosine Interaction Domain of APBB2 from Mouse
Class: protein binding
Keywords: phosphotyrosine-interaction domain, amyloid disease, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, PROTEIN BINDING
Deposited on 2004-05-28, released 2004-11-28
The last revision prior to the SCOPe 2.01 freeze date was dated 2008-11-04, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: amyloid beta (A4) precursor protein-bindin, family B, member 2
    Species: Mus musculus [TaxId:10090]
    Gene: RIKEN cDNA 1200015I07
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9DBR4 (7-129)
      • expression tag (0-6)
      • expression tag (130-135)
    Domains in SCOPe 2.01: d1wgua_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wguA (A:)
    gssgssgptpktelvqkfrvqylgmlpvdrpvgmdtlnsaienlmtssskedwpsvnmnv
    adatvtvisekneeevlvecrvrflsfmgvgkdvhtfafimdtgnqrfechvfwcepnaa
    nvseavqaacsgpssg