PDB entry 1wgu

View 1wgu on RCSB PDB site
Description: Solution Structure of the C-terminal Phosphotyrosine Interaction Domain of APBB2 from Mouse
Class: protein binding
Keywords: phosphotyrosine-interaction domain, amyloid disease, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2004-05-28, released 2004-11-28
The last revision prior to the SCOP 1.73 freeze date was dated 2004-11-28, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: amyloid beta (A4) precursor protein-bindin, family B, member 2
  Species: MUS MUSCULUS
  Gene: RIKEN cDNA 1200015I07
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9DBR4 (7-129)
    • cloning artifact (0-6)
    • cloning artifact (130-135)
  Domains in SCOP 1.73: d1wgua_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wguA (A:)
  gssgssgptpktelvqkfrvqylgmlpvdrpvgmdtlnsaienlmtssskedwpsvnmnv
  adatvtvisekneeevlvecrvrflsfmgvgkdvhtfafimdtgnqrfechvfwcepnaa
  nvseavqaacsgpssg