PDB entry 1wgt

View 1wgt on RCSB PDB site
Description: x-ray structure of wheat germ agglutinin isolectin 3
Class: lectin (agglutinin)
Keywords: lectin (agglutinin)
Deposited on 1995-04-17, released 1995-07-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wgtA (A:)
    ercgeqgsgmecpnnlccsqygycgmggdycgkgcqngacwtskrcgsqaggktcpnnhc
    csqyghcgfgaeycgagcqggpcradikcgsqaggklcpnnlccsqwgycglgsefcgeg
    cqngacstdkpcgkdaggrvctnnyccskwgscgigpgycgagcqsggcdgvfaeaiatn
    stllae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wgtA (A:)
    ercgeqgsgmecpnnlccsqygycgmggdycgkgcqngacwtskrcgsqaggktcpnnhc
    csqyghcgfgaeycgagcqggpcradikcgsqaggklcpnnlccsqwgycglgsefcgeg
    cqngacstdkpcgkdaggrvctnnyccskwgscgigpgycgagcqsggcdg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wgtB (B:)
    ercgeqgsgmecpnnlccsqygycgmggdycgkgcqngacwtskrcgsqaggktcpnnhc
    csqyghcgfgaeycgagcqggpcradikcgsqaggklcpnnlccsqwgycglgsefcgeg
    cqngacstdkpcgkdaggrvctnnyccskwgscgigpgycgagcqsggcdgvfaeaiatn
    stllae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wgtB (B:)
    ercgeqgsgmecpnnlccsqygycgmggdycgkgcqngacwtskrcgsqaggktcpnnhc
    csqyghcgfgaeycgagcqggpcradikcgsqaggklcpnnlccsqwgycglgsefcgeg
    cqngacstdkpcgkdaggrvctnnyccskwgscgigpgycgagcqsggcdg