PDB entry 1wgs

View 1wgs on RCSB PDB site
Description: Solution Structure of the Tudor Domain from Mouse Hypothetical Protein Homologous to Histone Acetyltransferase
Class: transferase
Keywords: Tudor domain, MYST family, histone acetyltransferase, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSFERASE
Deposited on 2004-05-28, released 2004-11-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-02-16, with a file datestamp of 2011-02-11.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MYST histone acetyltransferase 1
    Species: Mus musculus [TaxId:10090]
    Gene: RIKEN cDNA 5830450F21
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9D1P2 (7-126)
      • expression tag (0-6)
      • expression tag (127-132)
    Domains in SCOPe 2.07: d1wgsa1, d1wgsa2, d1wgsa3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wgsA (A:)
    gssgssgepevtveigetylcrrpdstwhsaeviqsrvndqegreefyvhyvgfnrrlde
    wvdknrlaltktvkdavqknsekylselaeqperkitrnqkrkhdeinhvqktyaemdpt
    taalekesgpssg