PDB entry 1wgr

View 1wgr on RCSB PDB site
Description: Solution Structure of the RA Domain of Human Grb7 Protein
Class: protein binding
Keywords: RA domain, Grb7, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, PROTEIN BINDING
Deposited on 2004-05-28, released 2004-11-28
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Growth factor receptor-bound protein 7
    Species: Homo sapiens [TaxId:9606]
    Gene: IMS cDNA HEP10521
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q14451 (7-93)
      • cloning artifact (0-6)
      • cloning artifact (94-99)
    Domains in SCOPe 2.04: d1wgra_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1wgrA (A:)
gssgssgrphvvkvysedgacrsvevaagatarhvcemlvqrahalsdetwglvechphl
alergledhesvvevqaawpvggdsrfvfrknfasgpssg