PDB entry 1wgq

View 1wgq on RCSB PDB site
Description: Solution Structure of the Pleckstrin Homology Domain of Mouse Ethanol Decreased 4 Protein
Class: sugar binding protein
Keywords: pleckstrin homoloy domain, signal transduction, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SUGAR BINDING PROTEIN
Deposited on 2004-05-28, released 2004-11-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: FYVE, RhoGEF and PH domain containing 6; ethanol decreased 4
  Species: Mus musculus [TaxId:10090]
  Gene: RIKEN cDNA 4933427A08
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q69ZL1 (7-102)
    • cloning artifact (0-6)
    • cloning artifact (103-108)
  Domains in SCOPe 2.06: d1wgqa1, d1wgqa2, d1wgqa3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wgqA (A:)
  gssgssgstmsgylyrskgskkpwkhlwfviknkvlytyaasedvaalesqpllgftvtl
  vkdenseskvfqllhkgmvfyvfkaddahstqrwidafqegtvsgpssg