PDB entry 1wgo

View 1wgo on RCSB PDB site
Description: Solution structure of the PKD domain from human VPS10 domain-containing receptor SorCS2
Class: membrane protein
Keywords: polycystic kidney disease, PKD, structural genomics, KIAA1329 protein, RIKEN Structural Genomics/Proteomics Initiative, RSGI, MEMBRANE PROTEIN
Deposited on 2004-05-28, released 2004-11-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: VPS10 domain-containing receptor SorCS2
  Species: Homo sapiens [TaxId:9606]
  Gene: KAZUSA cDNA fh14788
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q96PQ0 (7-116)
    • cloning artifact (0-6)
    • cloning artifact (117-122)
  Domains in SCOPe 2.06: d1wgoa1, d1wgoa2, d1wgoa3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wgoA (A:)
  gssgssgceggvdmqqsqvqlqcpltpprglqvsiqgeavavrpgedvlfvvrqeqgdvl
  ttkyqvdlgdgfkamyvnltltgepirhryespgiyrvsvraentaghdeavlfvqvsgp
  ssg