PDB entry 1wgn

View 1wgn on RCSB PDB site
Description: Solution Structure of UBA domain of Human Ubiquitin Associated Protein 1 (UBAP1)
Class: structural genomics, unknown function
Keywords: Ubiquitin Associated Protein 1 (UBAP1), UBA domain, Structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2004-05-28, released 2004-11-28
The last revision prior to the SCOP 1.75 freeze date was dated 2004-11-28, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ubiquitin associated protein
    Species: HOMO SAPIENS
    Gene: IMS cDNA STM00561
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NZ09 (7-56)
      • cloning artifact (0-6)
      • cloning artifact (57-62)
    Domains in SCOP 1.75: d1wgna_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wgnA (A:)
    gssgssgayselqmlspserqcvetvvnmgysyecvlramkkkgenieqildylfahsgp
    ssg