PDB entry 1wgm

View 1wgm on RCSB PDB site
Description: Solution structure of the U-box in human ubiquitin conjugation factor E4A
Class: protein binding
Keywords: ubiquitinating enzyme, KIAA0126, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, PROTEIN BINDING
Deposited on 2004-05-28, released 2004-11-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin conjugation factor E4A
    Species: Homo sapiens [TaxId:9606]
    Gene: Kazusa cDNA ha03786
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q14139 (7-91)
      • cloning artifact (0-6)
      • cloning artifact (92-97)
    Domains in SCOPe 2.07: d1wgma1, d1wgma2, d1wgma3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wgmA (A:)
    gssgssglqqqeeetyadacdefldpimstlmcdpvvlpssrvtvdrstiarhllsdqtd
    pfnrspltmdqirpntelkekiqrwlaerkqqsgpssg