PDB entry 1wgl

View 1wgl on RCSB PDB site
Description: Solution Structure of CUE domain in the C-terminal of Human Toll-interacting Protein (Tollip)
Class: immune system
Keywords: CUE domain, Toll-interacting protein (Tollip), Structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, IMMUNE SYSTEM
Deposited on 2004-05-28, released 2004-11-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Toll-interacting protein
    Species: Homo sapiens [TaxId:9606]
    Gene: IMS cDNA PNC02024
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H0E2 (7-52)
      • cloning artifact (0-6)
      • cloning artifact (53-58)
    Domains in SCOPe 2.06: d1wgla1, d1wgla2, d1wgla3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wglA (A:)
    gssgssgcseedlkaiqdmfpnmdqevirsvleaqrgnkdaainsllqmgeepsgpssg