PDB entry 1wgk

View 1wgk on RCSB PDB site
Description: Solution Structure of Mouse Hypothetical Protein 2900073H19RIK
Class: Structural genomics, unknown function
Keywords: ThiS domain, Ubiqutin-like fold, Structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2004-05-28, released 2004-11-28
The last revision prior to the SCOP 1.73 freeze date was dated 2004-11-28, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: RIKEN cDNA 2900073H19 protein
  Species: MUS MUSCULUS
  Gene: RIKEN cDNA 2900073H19
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9D2P4 (7-107)
    • cloning artifact (0-6)
    • cloning artifact (108-113)
  Domains in SCOP 1.73: d1wgka_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wgkA (A:)
  gssgssgmaaplcvkvefgggaellfdgvkkhqvalpgqeepwdirnllvwikknllker
  pelfiqgdsvrpgilvlindadwellgeldyqlqdqdsilfistlhggsgpssg