PDB entry 1wgk

View 1wgk on RCSB PDB site
Description: Solution Structure of Mouse Hypothetical Protein 2900073H19RIK
Class: Structural genomics, unknown function
Keywords: ThiS domain, Ubiqutin-like fold, Structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, unknown function
Deposited on 2004-05-28, released 2004-11-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RIKEN cDNA 2900073H19 protein
    Species: Mus musculus [TaxId:10090]
    Gene: RIKEN cDNA 2900073H19
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9D2P4 (7-107)
      • cloning artifact (0-6)
      • cloning artifact (108-113)
    Domains in SCOPe 2.08: d1wgka1, d1wgka2, d1wgka3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wgkA (A:)
    gssgssgmaaplcvkvefgggaellfdgvkkhqvalpgqeepwdirnllvwikknllker
    pelfiqgdsvrpgilvlindadwellgeldyqlqdqdsilfistlhggsgpssg