PDB entry 1wgj

View 1wgj on RCSB PDB site
Description: structure of inorganic pyrophosphatase
Deposited on 1996-10-24, released 1997-11-19
The last revision prior to the SCOP 1.55 freeze date was dated 1997-11-19, with a file datestamp of 1997-11-19.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.172
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1wgja_
  • Chain 'B':
    Domains in SCOP 1.55: d1wgjb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wgjA (A:)
    tyttrqigakntleykvyiekdgkpvsafhdiplyadkennifnmvveiprwtnakleit
    keetlnpiiqdtkkgklrfvrncfphhgyihnygafpqtwedpnvshpetkavgdndpid
    vleigetiaytgqvkqvkalgimalldegetdwkviaidindplapklndiedvekyfpg
    llratnewfriykipdgkpenqfafsgeaknkkyaldiikethdswkqliagkssdskgi
    dltnvtlpdtptyskaasdaippaslkadapidksidkwffi
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wgjB (B:)
    tyttrqigakntleykvyiekdgkpvsafhdiplyadkennifnmvveiprwtnakleit
    keetlnpiiqdtkkgklrfvrncfphhgyihnygafpqtwedpnvshpetkavgdndpid
    vleigetiaytgqvkqvkalgimalldegetdwkviaidindplapklndiedvekyfpg
    llratnewfriykipdgkpenqfafsgeaknkkyaldiikethdswkqliagkssdskgi
    dltnvtlpdtptyskaasdaippaslkadapidksidkwffi