PDB entry 1wgf

View 1wgf on RCSB PDB site
Description: Solution structure of the 4th HMG-box of mouse UBF1
Class: transcription
Keywords: Transcription factor, DNA binding, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2004-05-28, released 2004-11-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Upstream binding factor 1
    Species: Mus musculus [TaxId:10090]
    Gene: RIKEN cDNA 1300010N03
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25976 (7-83)
      • cloning artifact (0-6)
      • cloning artifact (84-89)
    Domains in SCOPe 2.07: d1wgfa1, d1wgfa2, d1wgfa3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wgfA (A:)
    gssgssgkpsqeggkggsekpkrpvsamfifseekrrqlqeerpelseseltrllarmwn
    dlsekkkakykareaalkaqserksgpssg