PDB entry 1wge

View 1wge on RCSB PDB site
Description: Solution structure of the mouse DESR1
Class: metal binding protein
Keywords: Diphthamide,CSL zinc finger, ADP-ribosylating toxin, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, METAL BINDING PROTEIN
Deposited on 2004-05-28, released 2005-08-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein 2610018L09Rik
    Species: Mus musculus [TaxId:10090]
    Gene: RIKEN cDNA 2610018L09
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8K0W9 (7-76)
      • cloning artifact (0-6)
      • cloning artifact (77-82)
    Domains in SCOPe 2.07: d1wgea1, d1wgea2, d1wgea3
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wgeA (A:)
    gssgssgmavfhdeveiedfqydedsetyfypcpcgdnfaitkedlengedvatcpscsl
    iikviydkdqfmcgetvsgpssg